PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000149841
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family TCP
Protein Properties Length: 115aa    MW: 12816.8 Da    PI: 10.4136
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000149841genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP85.51.2e-263093265
            TCP  2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgt 65
                   +g kdrhsk++  +g+RdR v l a++a++f+d+qd+L +d++sk ++WL+++ak+ai+el+  
  MDP0000149841 30 TGWKDRHSKVCKVKGPRDRCVWLAAHTAIQFYDVQDRLDYDRPSKVVDWLIKKAKAAIDELPPW 93
                   677**********************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036345.4E-243198IPR005333Transcription factor, TCP
PROSITE profilePS5136926.493290IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 115 aa     Download sequence    Send to blast
MGIRSPSSSG GVVNTDIVEV VQGSHIVRAT GWKDRHSKVC KVKGPRDRCV WLAAHTAIQF  60
YDVQDRLDYD RPSKVVDWLI KKAKAAIDEL PPWNPHSTST IAAAIVVRRK PILFS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008391670.11e-72PREDICTED: transcription factor TCP4-like
SwissprotQ8LPR52e-38TCP4_ARATH; Transcription factor TCP4
TrEMBLD5MRQ23e-51D5MRQ2_MALDO; MdTCP4A protein
STRINGGLYMA06G34330.11e-39(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF148631014
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15030.31e-39TCP family protein